4.65 Rating by CuteStat

intheflowbook.com is 4 years 2 months old. It is a domain having com extension. It has a global traffic rank of #5915389 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, intheflowbook.com is SAFE to browse.

PageSpeed Score
86
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 142
Daily Pageviews: 284

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 5,915,389
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.224.182.242

Hosted Country:

United States of America US

Location Latitude:

32.7203

Location Longitude:

-117.1552

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.224.182.242)

H-flashgames.com

- h-flashgames.com
Not Applicable $ 8.95

leze.com

- leze.com
Not Applicable $ 8.95

Ads-tricks.us

- ads-tricks.us
53,220 $ 335,520.00

musicindiaonline.co

- musicindiaonline.co

This domain may be for sale!

Not Applicable $ 8.95

repa4ok.biz -&nbspThis website is for sale! -&nbsprepa4ok Resources an

- repa4ok.biz

This website is for sale! repa4ok.biz is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, repa4ok.biz has it all. We hope you find what you are searching for!

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Wed, 18 Mar 2020 18:14:42 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Check: 3c12dc4d54f8e22d666785b733b0052100c53444
X-Language: english
X-Template: tpl_CleanPeppermintBlack_twoclick
X-Buckets: bucket011
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBALquDFETXRn0Hr05fUP7EJT77xYnPmRbpMy4vk8KYiHnkNpednjOANJcaXDXcKQJN0nXKZJL7TciJD8AoHXK158CAwEAAQ==_H8taJWTxGDeTRV59ZU2DAjmvZOpoh1Ww3JOhVZjoSiM1FGrB5LlaCEd/IYlYE5a1WndMxJ5qDhEhwxSNzy69uQ==
Content-Encoding: gzip

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Mar 7, 2020, 1:04 AM 4 years 2 months 1 week ago
Expiration Date: Mar 7, 2021, 1:04 AM 3 years 2 months 1 week ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
271.ns1.above.com 103.224.182.5 Australia Australia
271.ns2.above.com 103.224.182.6 Australia Australia

DNS Record Analysis

Host Type TTL Extra
intheflowbook.com A 3600 IP: 103.224.182.242
intheflowbook.com NS 86400 Target: ns1.above.com
intheflowbook.com NS 86400 Target: ns2.above.com
intheflowbook.com SOA 60 MNAME: ns1.above.com
RNAME: hostmaster.trellian.com
Serial: 2020031901
Refresh: 10800
Retry: 3600
Expire: 604800
Minimum TTL: 3600
intheflowbook.com MX 3600 Priority: 10
Target: park-mx.above.com

Similarly Ranked Websites

Apache HTTP Server Test Page powered by CentOS

- mixedproductsmedia.com
5,915,395 $ 240.00

The domain name gigpad.com is for sale

- gigpad.com

Purchase gigpad.com today. Starter logo included. Money back guarantee. Fast domain transfer.

5,915,400 $ 240.00


New Westminster Family Practice

- newwestminsterfamilypractice.ca
5,915,407 $ 240.00

Domain Default page

- tenisdemesa.com.br
5,915,408 $ 240.00

Full WHOIS Lookup

Domain Name: intheflowbook.com
Registry Domain ID: 2500561704_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2020-03-06T19:19:49Z
Creation Date: 2020-03-06T19:19:48Z
Registrar Registration Expiration Date: 2021-03-06T19:19:48Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Above.com Domain Privacy
Registrant State/Province: Victoria
Registrant Country: AU
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=intheflowbook.com
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=intheflowbook.com
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=intheflowbook.com
Name Server: 271.NS1.ABOVE.COM
Name Server: 271.NS2.ABOVE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-03-18T18:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.